SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G123624_T02|PACid:20864556 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G123624_T02|PACid:20864556
Domain Number 1 Region: 23-234
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-24
Family BAR domain 0.075
Further Details:      
 
Domain Number 2 Region: 239-335
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G123624_T02|PACid:20864556
Sequence length 347
Sequence
MKQFGGGYGADGVFADEAEAQQHSKLEKLYISTRAAKHFQRDIVRGVEGYIVTGSKQVEI
GNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMMEKERGNLLKALGTQVAEPLRAMV
MGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLREASGNSDMISRLEAAESKLQELK
SNMGVLGKEALAAMTAVEGQQQRLTLQRLIALVESERNYHQKVLQILDQLEREMVSERQR
IEGAPPPVVESSMPPPPAYEEVNGIFMRNTVAELVETVEYFLAEAIQSYRAESDTELNLS
AGDYIVVRKVSNNGWAEGECRGRAGWFPYDYIEKRERVLASKVAQVF
Download sequence
Identical sequences A0A1D6KR16
GRMZM2G123624_T02|PACid:20864556 GRMZM2G123624_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]