SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G124476_T02|PACid:20874540 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G124476_T02|PACid:20874540
Domain Number 1 Region: 175-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 271-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000536
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 105-135
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000406
Family CCCH zinc finger 0.0028
Further Details:      
 
Domain Number 4 Region: 38-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000549
Family CCCH zinc finger 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G124476_T02|PACid:20874540
Sequence length 306
Sequence
MEGNVAAGKRSRTETANGAAGGGKRSKDMESFQTGLSSKSKPCNKFFSTIGCPFGEGCRF
LHFVPGGYPAVAKMLNLGSPAVSAPSRTHVDHAALTGTSHSASSGKTRMCTKYNTTEGCR
FGDKCHFAHSERELGKPAYMPYGEPPMGGRFGGRPEPVQPAAMGPPAGNFGASATAKISV
DASLAGGIIGKGGVNTKQISRVTGVKLCIRDHESSPNLKNIELEGNFDQIKQAGEMVRDL
IATISTSMPAKNSSAAVAPAGGRGGGLGSKSNYKTKLCENFAKGACTFGERCHFAHGENE
QRSGAV
Download sequence
Identical sequences B4F7X6 K0DG22
GRMZM2G124476_T02|PACid:20874540 NP_001130092.1.34533 GRMZM2G124476_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]