SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G127650_T01|PACid:20851340 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G127650_T01|PACid:20851340
Domain Number 1 Region: 486-771
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-79
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 114-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000654
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G127650_T01|PACid:20851340
Sequence length 801
Sequence
MPGTAMEAPKRSCSPSGPRGCATPTFLFSIVLLLALAVAASVTDTILPGAGISGNQTLVS
KNGDFELGFFLPGAGIHRFLGVRFKKMPGTSPTFWVGDRVVISDISAAALEVFGGSLCIT
EAGSTLWCSSVAGAGPGPPPPSAAAAAVLLGNGNLVVRDQADDASSRVLWQSFDYPGDSL
LPGARLGLAAGTGANVSLTYRDFSHNGSLSVDPSRRNGFVLSTDGHPSSLGTFPDWMVTS
QDNGTSLVLNPPPDSSNLTEFLQFSLGQVSLMRWSAAANTNSSGWVARWTFPSDCKSSGF
FCGSFGACRSNGECSCVRGFEPSYPAEWSLGYFATGCSRPRSLPLSCQTNGQTEQDDSFI
LLDKLQGLPYNPQDGLAATDEDCKQACLSRCYCVAYAYHSGCKLWYYNLYNLSFASRGPP
PYSKVYVRWGSKLRPKSGLRTGLIVSMVVGSVALAAVIVILALLWRSRTWRGVFTCSRRE
FEAGGSLAFYSYAQMKKATRNFSDKLGEGGFGSVFRGTMAGPTAVAVKRLKRSGQADKQF
RAEVQTLGVIKHANLVRLLGFCVRGDTRLLVYEYMPNGSLDAHLFSERSARLSWSLRYQI
ALGIAKGIAYLHEECEDRIIHCDIKPENILLDSELRAKIADFGMAKLLGREFDSALTTVR
GTMGYLAPEWISGRPVTRKADVYSFGIVLLEIVSGRRSTARLRSGSGSHRYFPLHAAARV
SEGDVLCLLDSRLGGDADVEELDVACRVACWCVQDDEGDRPSMGQVVRMLEGVVSVAVPP
IPSSFQNLVEGEGSVIYSDEE
Download sequence
Identical sequences K7UZN2
XP_008655789.1.34533 GRMZM2G127650_P01 GRMZM2G127650_T01|PACid:20851340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]