SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G134432_T01|PACid:20842066 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G134432_T01|PACid:20842066
Domain Number 1 Region: 483-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-75
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 74-178
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-25
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  GRMZM2G134432_T01|PACid:20842066
Domain Number - Region: 350-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00275
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G134432_T01|PACid:20842066
Sequence length 811
Sequence
MHVVRAFVLSVLLVILHAPSPYAATDTLRHGHALAGSDKLVSGNGKFALGFLQLQPGSSY
YLGIWFDKVPVLTPVWAANRDNPVSANSTWRELVISDDGNMVFQAQGATVWSTRANTTTN
DTVAVLLGNGNLVLRSASNSSLTFWESFDYPTDTQLPGVKVGWNKVTGLNRRLVSRKNAV
DLSSGIYSSTLGRDGVARMLWNSSSVYWSSTWNGRFFSAVPEMSAGSPLANFTFVNNDQE
VYFTYNIFDESTIVRTTLHVSGQNQVRVWTGQDWMTGNNQPAHQCDVYAVCGPFAVCEPN
GDTLCSCMKGFSVRSPSDWEVEDRTGGCVRDTPLLSCGAGDGNSGTGMAADKFYSMPGIR
LPQNGKAMPADASSAKQCAQVCLSSCSCTAYSYGKDGCSIWHGELLNVATEGDSDDTIYL
RLAAKEFRSGKGSSRSGVVIGAAVGASVAAAAALVFVLLVLIWRRNGRRWSRPVVHNDKG
SVVGIVAFKYADLQDATKKFSEKLGEGGFGSVFKGCLGDSTTTVVAVKRLDGARQGEKQF
RAEVNSIGIVQHINLVRLIGFCCEGDRRLLVYEHMPNGSLDSHLFRSHGGAGVGAGAALD
WNVRYKIAVGVARGLAYLHHGCRDCIIHCDIKPQNILLDASFLPKIADFGMAKFLGRDFS
RVVTTMRGTVGYLAPEWISGTPITSKIDVYSYGMVLLEIVSGKRNSITQQSSSHTIEGQQ
GDYLPVQVAGKLLRGDVLSVVDADLRGDVNVEEVERVCRIACWCIQDREFDRPTMVEVVQ
FLEGICEPEIPPMPRLLHAIAGGGSNQTAGV
Download sequence
Identical sequences A0A1D6EB48
GRMZM2G471787_P01 GRMZM2G134432_T01|PACid:20842066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]