SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G135378_T01|PACid:20873113 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G135378_T01|PACid:20873113
Domain Number 1 Region: 486-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-76
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-26
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  GRMZM2G135378_T01|PACid:20873113
Domain Number - Region: 356-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G135378_T01|PACid:20873113
Sequence length 811
Sequence
MHRLRHFALHVLLLVIAHAPLPSAAVDTLRPGQALAGWKKLVSANGKFALGFFQLQPGSS
YYLGIWFDEVPVLTPVWTANRDNPVSNSTSPELTISGDGNMAVVLAESGTTTVWSTSTEA
NATSNDTVAVLLDSGNLVLRSSSNSSLVFWESFDYPTDTQLPGVKIGWDKVTGLDRRLVS
RKNSVDLSSGLYSSTMGHDGVARMLWNSSAVYWSSTWTGGFFSAIPEMSAGSPLANFTFV
DNAREVYFTYNIFDESTVIRTTLHVSGRNQVRVWTGQDWMTVNNQPAHQCDAYAVCGPFT
VCTDSASDADPSCDCMRGFSVRSPAEWAVKDRTGGCVRNTPLNCAADGRNRTGVPADKFY
SMPGVRLPQNGRQSMPNASSAIECAQACLSSNCSCTAYSYGGEDGCSLWHGELVNVAADG
NEGMIYLRLAAKELESGKGNRIAMVAGVAALVLVLVVVVVICSRRNNGKWWSRPIADSDK
GGSVVGIATFKYADLQDATKKFSEKLGAGGFGCVFKGRLAGDSTDIAVKRLDGALGNVQG
EKQFRAEVNSVGFIQHINLVKLIGFCCEGDRRLLVYEHMPNGSLDSHLFQFQSCRRRAPL
DWSTRYQIAVGVARGLGYLHHGCRDCIIHCDIKPQNILLDASFAPKIADFGMAKFLGREF
SRVVTTMRGTVGYLAPEWISGTPVTPKVDVYSYGMVLLELVSGKRNYVEHSSSCAEGQGD
YLPVQAAHKLLHGDVLSVVDADLHGELNVEEAERVCRVACWCIQDLESDRPTMIEVVQFL
EGICQVEIPPMPRLLTAIAGSGSHQTRVSSL
Download sequence
Identical sequences K7TKD2
GRMZM2G135378_T01|PACid:20873113 XP_008663194.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]