SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G152120_T01|PACid:20839430 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G152120_T01|PACid:20839430
Domain Number 1 Region: 510-806
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 77-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-18
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Weak hits

Sequence:  GRMZM2G152120_T01|PACid:20839430
Domain Number - Region: 373-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00353
Family Hairpin loop containing domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G152120_T01|PACid:20839430
Sequence length 852
Sequence
MLSQHVLTLTIFLFFLVCFCHSLHDRLTSVTPLYPGDKLVSDNGGMFALGFFNLTTVNST
RSLYLGIWYNNIPERTYVWVANRNSPITTPSAKLVLTNTSRLVLSDSEGRVVWATDNSVV
AGGSGTGTGGSGVLRSTGSFELELQLPNGTAGVVWKSLDHPTDTILPTFRLWTNYRAHTA
VRVVAWKGPRDPSAGEFSLSGDPGSRGLQIVIWRGTGTGTAGGRSWRSGVWNGAGAFSSI
NRFVYSQVVDDGGTIYAAYNAAGGPTTHWKLDYTGNVSLRVWNVESSSWSVLFEGPGTGC
LGYGACGPFGYCDATGRDGGVQECKCLDGFEPEDGFFRDFSRGCRRKEALQACGGGGEGG
GGRRHYFLALPGMKVPDKFLYVRNRSFEECAAECDRNCSCTAYAYANLSGIVTMSATSDV
SRCLLWMGELVDTGKDSDLGENLYLRLAGSPGNNNKKKIGSMAMEIVLPVMACLLMLTSC
VCLVTICKSRARTRRWNKEAHERSVHGFWDQNPELSCTSFAELKAATNSFHEANLLGQGG
FGKVYKGTLEDGREVAVKRLSNGSEQGKEQLRNELVLIASLQHKNLVRLLGCCIHEDEKL
LIYEYLPNKSLDKFLFDPALKSMLDWPKRFNIIKGVARGILYLHQDSRMVIIHRDLKASN
ILLDAEMDPKISDFGIARIFGCREQQATCFACEMVRTHSGYMSPEYTMEGIFSVKSDTYS
FGILLLEIVSGLKISAPPHLLTGYPSLIAYAWNLWKDGTAREFVDAMVVESRCSLDEALQ
CIHIGLLCVQDSPNDRPLMSLVVSMLNNEAAPRPVPSQPLFFAQRYHEALATRGDYSEHS
ANDVSLSMLQGR
Download sequence
Identical sequences GRMZM2G152120_T01|PACid:20839430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]