SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G169704_T01|PACid:20867422 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G169704_T01|PACid:20867422
Domain Number 1 Region: 123-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000236
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G169704_T01|PACid:20867422
Sequence length 320
Sequence
MELLPCIATLLILLISSSLAAATSPVGTIERVTKQQILASIPPGGGPPVLFLTSPSGKYA
AYFVRTHTVPGAGGLGADFCYVEIIDTTTAAGAHGGTVEGEGEGEGEGESEAGAAGAAAG
GTSVWESECRPISTVNTCALLLSWHGLEVFDGSEEVWHGETNTDGTNFLETLELVDDGDM
RIRDKDGELAWRASDEPRHAQHCGAPGSPGLATALPPFAEPLGAHSSNLPFGQEPDGNGH
SAELPQAADVGSGEAAFGAAAGVAGPELGQGEHDSASVFGAQPLVDNSPYDSRAWKEGRG
AHIIAVWVALCVSAVLGGGL
Download sequence
Identical sequences B4FKS5
NP_001136828.1.34533 GRMZM2G169704_P01 GRMZM2G169704_T01|PACid:20867422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]