SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G173978_T01|PACid:20881416 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G173978_T01|PACid:20881416
Domain Number 1 Region: 1040-1184
Classification Level Classification E-value
Superfamily VC0467-like 6.28e-23
Family VC0467-like 0.0011
Further Details:      
 
Domain Number 2 Region: 855-904,931-988
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000161
Family PDI-like 0.0069
Further Details:      
 
Weak hits

Sequence:  GRMZM2G173978_T01|PACid:20881416
Domain Number - Region: 39-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00117
Family PDI-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G173978_T01|PACid:20881416
Sequence length 1195
Sequence
MRLLLTAAWPCAILLILASALQSATVASSGAAAARLEWQVLTRANFSSQIRLRPHVLLLV
TMPWYGESRSLMADIERLVGSNEELSRLKLMVVYKNSEKLLTDAIGAAEGITVVYYQRSM
QFKYQGKLRAHDILSAVRYIMSLDHEESPFEVLHTQEDVETFIESTDKSILLYESCGWFT
RLAHGGGNQSYEAASSNNNTENVDISGKIMTREPDGPLELVIENEEQTFGVGGQLTGSPW
KVGFALANESVSEQIGNTNDGYRKCTMQKFHQFESFYGKLTAIAREYLLPPEIAKFGLIT
ERSLLPSLDVVNEGNQDTWFVITHHMGCKTCSVIAKDGDDLRSIVQSHHNLGIKEVSADE
SSREAIFPRNRPSVVLFIDRLSHSSKVRDESKLVLKLLRQYVQNNYPFHVSNGVPSSSTS
KARSKAVPSLRNTGISDAYSQTARLSAWASKLMALGDKMSVMVVNDGDSISYKSSSQGSG
ANPVYDVLTKLLDKARPGHKSKKTRISLVSRDVGLKMLSDHSEIKVVKSLSVEESEYKRT
DDASATTANSNDDITEAFVDENTAKETEYINDGQVPSILEKSSATYPDEHDTAREFNDTE
IEDKSISEASDMSVDLKEDAPNNADSSSEVGGMLHKHIMEKTVTEAFQILEHDERNLYTD
QEESVSSNEQVDGSSFLSKKISKTEDAIYENTFGLSEGLEESDRRCPHHATCSSSCVPVR
DDTDFTDQVTSSISDYRFAGAFYFSDGGYRLLRTLTGGSRIPSLVIIDPVEQKHYIFPEE
SEYSYASLQNYLDSFRNRSLPSYYRGTSSAISSKEFPRPPFVNHDFHEANSIPQLTAFSF
CPLVFGPRGCDSKSEVSFSNTENIVSGWNKDVMVLFSNSWCGFCQRAELVVRELHRSFKS
FSSYSDSVSRNAQDVHNEEKSEEYVMKGFPAIYMIDCTSNECHHLLKSAGMEELYPALLL
FPAENKSAIAYEGGMSVSHLIEFLESHVSNSRYLLEYKGFMWKKRMTPQHDAPQAIQFKV
SDKGSGNVGSELPSHPGVVTGSILTATKKLGTAVPFDNAKVLIVSADSHEGFHGLIINKR
LSWGVFKDLDSSMEPIKHAPLFYGGPVVVQGYHLVSLSRVSSEGYMQVIPGVYYGNIVAT
SRVVTRIKLGEQSVNGLWFFLGYSGWGYNQLFDELTEGAWLVSVKPIEHLDWPKS
Download sequence
Identical sequences A0A1D6GP57
GRMZM2G173978_T01|PACid:20881416 XP_008644171.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]