SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G175288_T01|PACid:20843020 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G175288_T01|PACid:20843020
Domain Number 1 Region: 456-655
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-50
Family Protein kinases, catalytic subunit 0.00076
Further Details:      
 
Domain Number 2 Region: 58-150,181-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  GRMZM2G175288_T01|PACid:20843020
Domain Number - Region: 306-337
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0149
Family Hairpin loop containing domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G175288_T01|PACid:20843020
Sequence length 867
Sequence
MAYLYLPVLIFQFMVCFCQSVDRLTPAKPLLHGDVLISNGGVFALGFFSLKNSTSSSYVG
IWYNNIPERTYVWIANRDNPITTNAPGKLVFTNSSDLVLLDSTGHTIWMTKNNITAGEGG
TAAILLDSGNFVVQSQNGTDIWESFHYPTDTMVPDVSFSLSSSDVAKRLVAWKGPDDPSS
SNFSMGGDSSSDLQIVTWNGTRPYWRRAAWGGEVTFGTFEGNTSFMVYETIVDTGDGYYM
KLTVSEGSPSIRLTLDYTGMLTFRRWNVNTSSWAVFGQFPRCRRKEELKCGGGDKFLTLP
SMKTPDKFLYIKNRSFDQCTAECSNNCSCTAYAYANLQNVDTTHDTTRCLVWMGELIDAE
KLSNTFGENLYFRVPTSPELKDFTSSPCKALNAHVTKMSCSQKNHLSNVRCGQNEMFFKC
FLFVDHIYAVSKKKSTVLKIVPVATANLGLKNLDLPSVSFEDIITATNNFSEHKLLGEGG
FGKVYKGVLEGGKEVAIKRLSKGSVQGIQEFINEVILIAKLQHRNLVRLLGFCIHEDEKL
LIYEYLPNRSLDAFLFDMCPKISDFGTARIFSGSEQQVNTTRVAGTYGYMSPEYAMEGSF
SVKSDTYAFGVLLLEIAWSLWKDGNALELVDSSISVSYSLQELVRLAATVAPSARSGKPY
GQLSDALPFSLTPDEGEDCALRYALFSRKPAPARDGGKFQVHFASSGRLSGTRARRGDAA
ADLAAQGRFGAGGAHLIMASSTEDNMKALLKVLVDCAEDATKTLGGLVDHALDHMHDEEI
VARTLYAIKDKLELLQQDALEAKVQAFPEIVKYDGDDISVEPTSPSTPPTVTEPSIDEEE
FYCPDVSDEWYFSDSDRSTRTSYWNIY
Download sequence
Identical sequences GRMZM2G175288_T01|PACid:20843020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]