SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G178449_T01|PACid:20871726 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G178449_T01|PACid:20871726
Domain Number 1 Region: 83-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-25
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  GRMZM2G178449_T01|PACid:20871726
Domain Number - Region: 362-423
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0981
Family Anti-platelet protein 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G178449_T01|PACid:20871726
Sequence length 452
Sequence
MSIRRRHLIGVHVVTLSLLITLAPGTPASDMIYTGGKLIDGNTLVSAGGSFTLGFFSPPG
EPTKRYLGTWFSFSAPTPDATAIYWVANRDRPLAGTSSALVLTTSGTLLLLDGTTNDTVW
SSGSTASTPPAGARILDSGNLVVVQGRNNSTALWQSFDHPCNSLLPGMKIGQNLWNGDEW
YLSSWRSPTDPGPGSYRYITELGGGTPENVMRDSGSAKRYRTGPWNGERFDGVPEMASYS
SYFTYQVTVSPSEATYSYNAKPGAPYSQLRLGDAGVVQRLVWDAGSRQWNSFLKEPRDDC
DDYAHCGAFGLCDRNAASTSLCTCFKGFVPAVPKEWSLREYSDGCRRNVSLDCGGSNRSR
SSTDGFQVVPLVKLPDTQNATVDMAISLDECGLRCLANCSCVAYAAADATGGGCIIWTDS
FTDLRFVEKGQDFYLRLPKSLLGPQNDDLFTF
Download sequence
Identical sequences GRMZM2G178449_P01 GRMZM2G178449_T01|PACid:20871726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]