SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G301124_T01|PACid:20874668 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G301124_T01|PACid:20874668
Domain Number 1 Region: 485-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-74
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 66-160,192-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  GRMZM2G301124_T01|PACid:20874668
Domain Number - Region: 353-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0108
Family Pan module (APPLE domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G301124_T01|PACid:20874668
Sequence length 814
Sequence
MLLLQVILLGLLSLHAPSNSATATDTVSPGNGLAGSSRLVSNNSKFALGFFRMDSKSFNY
ATNPYTYLGIWFNKVPKLTPLWSANGESPVMDPASPELAIAGDGNLVILDQATRSVIWST
HANTTTNDTVAVLQNNGNLVLRSSSNSSTVFWQSFDYPTDTFFAGAKIGWDKVTGLNRRL
VSRKNLIDQAPGLYTGEIQKNGVGHLVWNSTVEIESTGLWNGQYFSSAPEMIGNTVSITT
FEYVNNDKEVYFTWNLQDETAIVLSQLGVDGQGMVSLWIDKDWVVMYKQPVLQCDAYATC
GPFTVCDEGENEGPICNCMKGFSVSSPRDWELGDRRDGCTRNTPLHCGRSRNTDKFYAPQ
NVMLPQDAMKMQAATSDEDDCSRACLGNCSCTGYSYGEGGCSVWHGKLTNVKKQQPDGNG
ETLYLRLAAKEVPGVPRKNSRIFRFGAAIIGASAAAVAALMILGLMMTWRRKGKLFTRTV
GDAQVGIGITTFRYVDLQHATKNFSEKLGGGSFGSVFKGYLSDSLALAVKRLDGANQGEK
QFRAEVSSVGIIQHINLVKLIGFCCQGDQRLLVYEYMPNHSLDAHLFKVGSDTVLEWNLR
YQIAIGVARGLAYLHTGCRDCIIHCDIKPENILLDASFVPKIADFGMAKVLGREFSDAIT
TMRGTIGYLAPEWISGEAVTSKVDVYSYGSVLFEIVSGRRNSSQEYSKDGDYSAFFPVQV
ARKLLSGDIGSLVDASLHGNVNLEEVERVCKVACWCIQDSEFDRPTMTEVVQFLEGVSEL
HMPPVPRLLDAITGGATNTKIYSMLSVEGSPTSV
Download sequence
Identical sequences K7UC64
GRMZM2G301124_P01 GRMZM2G301124_T01|PACid:20874668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]