SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G301738_T01|PACid:20847956 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G301738_T01|PACid:20847956
Domain Number 1 Region: 489-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-76
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 99-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000353
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G301738_T01|PACid:20847956
Sequence length 810
Sequence
MGAAKRVVCWRPSAAPLATCFFSLAVATLAAASDTILPGGDGISGNQTLVSQNGVFELGF
FSPGTDIYHFLGVRIRNMPGDAGTTPTFWFGDRVYISDLSSAALQLIGDRLYITENGTNL
WWSSVAGAAAAASAAYSAVAAVLLDSGNLVVVARDQANSSSSRVLWQSFDYPGDALLPGA
RLGLDGDTGTNVSLTYRNANSWHSSSLSVDVDPRRRNGFVLTTDGWDVHRGTFPAWMVSS
QGNGSSLVLLNNTRPGPGLGPAADGAGMVAEHLQLHLGQVSLRSWSSSAGCWVARWTFPS
DCRSSAFFCGRFGVCTSAGTCACVDGFEPSKPCEWQRGYFVDGCTRSHPLSCTADDSGRQ
DDSFLLLDNLRGLPYSSIPQNDTAAQGDEGCREACAGKCYCVAYAYDDSGCKLWYNYLYN
VSFAATPPYSKVYLRLASSEPVVQKGPRTVSSIVLMAVGLAAAAACVISILLALLRRYRD
RRKFQQRAEGSLSVYPYAEVRRATRNFSDKLGEGGFGCVFRGTMPGPGPGPTAVAVKRLK
GLGRADKQFGAEVQTLGVIRHTNVVPLLGFCVKGSTRMLVYQYMDNGSLDAHLFSGSPCC
RLLDWGLRYRIAHGVARGLAYLHEECQDCIIHCDIKPENILLDAEFRAKIADFGMAKLLG
REFSSALTTIRGTMGYLAPEWVSGQPITKKADVYSFGIVLLEIISGRRMTRRLKSGSHRY
FPLYAAVQLNEGNVLCLLDPRLEGHADVRELDVACRVACWCIQDEENDRPSMAQVVRMLE
GVVDAEIPPVPSSFKDLIEGDNSSTCSEEG
Download sequence
Identical sequences A0A1D6EWT3
GRMZM2G301738_T01|PACid:20847956 GRMZM2G301738_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]