SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G303909_T01|PACid:20869691 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G303909_T01|PACid:20869691
Domain Number 1 Region: 484-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-75
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 61-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-19
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  GRMZM2G303909_T01|PACid:20869691
Domain Number - Region: 363-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00228
Family Anti-platelet protein 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G303909_T01|PACid:20869691
Sequence length 796
Sequence
MAAPLLLPLILLLSSTPPLQAQQNITQGSSLTPQGPTTSWHSPSGDFAFGFQPIDGNTSV
YLLAIWFNKIGNLTVTWYAKTSDQDPVPVQVSSGSRLQLNSNGALSLQDSTGTEVWSPQV
VGASYAAMLDSGNFVLAAADGSTRWESFKYPTDTILPTQVLTPGMSLRSRIIPTDYSNGR
FLLDLQSTGVSLYTVAVPSGYKYDPYWSMDVNTTDLVFNATGAIYIGNNTEITSWVISSI
ADYYLRATLDPDGVFRQYMYPKKDNNQSNQAWSAVDFKPPNICGAQLTKIGSGICGFNSY
CLWNGANNQSTCKCPDQYSFIDGERKYKGCKPDFQPQSCDLDEAAIMTQFMLMPTSLVDW
PLSDYEQYTSITKDQCQKLCLTDCFCAVAVFHSEDNTCWKKKMPLSNGNMADNVQRTVYI
KVRKNNGTQSEITDPNKWKKDKKNWIIGSSLFLGSSVLVNILLISIILLGSYCTITIKQV
PAMQSSNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDK
LAHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDAKLQ
WSIRAQLVLGVARGLVYLHEECSTQIIHCDIKSQNILLDDNFTAKISDFGLAKLLRTNQT
QTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTD
WANDCYRYGRIDFLVKGDEEAISDLKNVERFVAVALWCLQEDPTMRPTMLKVTQMLGEAA
VVPSPPDPTSFVSTLA
Download sequence
Identical sequences A0A1D6KCZ0
GRMZM2G303909_T01|PACid:20869691 XP_008660212.2.34533 GRMZM2G303909_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]