SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G309512_T01|PACid:20827054 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G309512_T01|PACid:20827054
Domain Number 1 Region: 488-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-72
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 75-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000103
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Domain Number 3 Region: 176-279
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000489
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G309512_T01|PACid:20827054
Sequence length 789
Sequence
MALPIRLLSWLALATLLSVPGAAAQPVTNITAGNSLQAAAGAAWPSPSGRFAFGFYVTDG
GLAVGVWLATTPNVTVTWTANRNVTPSTGGALWVTYDGRLVWTGPADGQDRPLAVPPRPA
TAAAMRDDGSFVLYGADGAMVWSTFAAAPTDTLLPGQDLVPGAQLFSSVSPTNSATGRYR
LTNQINDGNLVLYPVQTENTANAAYWATGTFQIGFPLTLRIDTTGVLYVTGNGGNYTKNL
TLPWAAPSPGEADVFYRVTLDPDGVLRLYRHAVTRGGAWTTGVQWVGPNDRCHVKGACGL
NSYCVLSRDAQPDCRCPPGFGFIDAADATLGCTETSSAGGCAAAGSSAAPAMAAMQNMSW
ADTPYAVLGAGTSAADCQAACVADCLCAAVLLDSSDGTCTKQQLPLRYGHAGGGFTLFVK
NAVGGPALDGGRDRRVGRSTTVALVCIGILTFVSLAALVAAVRLVLANRRTTAEPDAAEA
LDEEAPLRSYSYQELDHATWSFREPLGRGAFGTVFRGTLLYSGGEKAIAVKRLEKMVEEG
ELEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFKNSGGGGPPGW
DERMGIALDVARGLRYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLQPEQTR
TFTGVRGTRGYLAPEWYRGAGPVTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMEC
AHEWLVRGEVWRVVGGDDAVDVTEVERAVKVAVWCAQAEPQARPDMRSVILMLEGLVEVP
FPPPPPASL
Download sequence
Identical sequences A0A1D6N0I9
GRMZM2G309512_T01|PACid:20827054 XP_008674493.1.34533 GRMZM2G309512_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]