SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G322361_T01|PACid:20836626 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G322361_T01|PACid:20836626
Domain Number 1 Region: 487-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-57
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 62-147,184-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000537
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Weak hits

Sequence:  GRMZM2G322361_T01|PACid:20836626
Domain Number - Region: 357-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Hairpin loop containing domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G322361_T01|PACid:20836626
Sequence length 666
Sequence
MAFPSSISIYTAALLLLLSTLGASDDRLVPGKPLMPGTIIVSDGGEFAFGFFAPSNSTPE
KLYIGIWYNNVPRLTAVWVANRAAPAISSSAPSLVLTNDSNLVLSDVNGRVLWKTNTTAA
GTGSFIAVAEDGERYLDPWAVLSNSGNLIPTVTDWHHEYGRELQDRMKPTTLFSWKDADD
PFVGYLLFSRGDRPIIQWFIRNGSVPEWRSNVWTGFTVSSQFFQANTSVGVYLTFTYVRT
ADEIYMVFTTSDGAPPIRTVMSYSGKLETSVWNRNSSEWTTLVVSPDYECSRYSYCGPSG
YCDHSDATPTCKCLEGFEPVDREGWSSARFSRGCRRKEALRCGDGDGFLALTDMKVPDKF
VRVGRKTFQECAAECSGNCSCVAYAYANLNASAANGDATRCLLWIGDHQLVDSQKMGVLL
YSTAGADSQETLYLRVAGMPGKGQNQHMRIMLPILQLVLSHLHLLIWVCKFRGGLGEEKT
SNDSELPFLKFQDILVATDNFSNVFMIGQGGFGKVYKGTLEGGQEVAIKRLSRDSDQGTQ
EFRNEVVLIAKLQHRNLVRLLGCCIDGDEKLLIYEYLPNKSLDAIIFNCARNAPLDWATR
FKIIKGVARGLLYLHHDSRLTIIHRDLKASNVLLDAEMRPKIADFGMARIFGDNQENANT
KRVVGT
Download sequence
Identical sequences GRMZM2G322361_T01|PACid:20836626 GRMZM2G322361_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]