SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G322723_T02|PACid:20825953 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G322723_T02|PACid:20825953
Domain Number 1 Region: 546-831
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 93-185,217-247
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.64e-22
Family alpha-D-mannose-specific plant lectins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G322723_T02|PACid:20825953
Sequence length 879
Sequence
MRDATRGTHAAAEALAARRPRRAMASPLLCGCALLLYLLGHLATCHAARDTITPSSPLAA
NETLVSGGDGNFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGAT
LSVSGGGTLAIAAGNGTVVWSVRSASSRRLASPAAQILDNGNLVLKDGAGGGGAVAWEGF
DYPTDTLLPEMKLGIDYVKGKNRTLTSWKSPSDPSTGPVAMVMDTTGDPQVFIWNGGEKV
WRSGPWDGVQFTGVPDTATYSGFTFSFINSAQEVTYSFQVHNASIISHLGVVSSGNYGLL
QRSTWVEAARAWNLYWYAPKDQCDAVSPCGANGVCDTNNMPVCSCLRGFTPRTPAAWALR
DGRDGCVRSTPLDCRRNGTTSTTDGFVAVRHAKVPDTERSAVDWSLTLEQCRQACLRNCS
CTAYASANVSSGGGGRGGGAGGGSGCVMWTTGLTDLRVYPDFGQDLFVRLAASDLDVLEG
RSRAARIRIAVGVSVSLLALLLAVAGLLIWLRKRRLTRTAGSSKWSGSRSTGRRYEGSSH
GDDLELPIFDLGTIAAATDGFSINNKLGEGGFGPVYKGKLEDGMEIAVKTLSKTSAQGLD
EFKNEVLLIAKLQHRNLVRLLGCSISGQERMLVYEYMANKSLDFFLFEKDTVVLDWQVRY
RIIEGITRGLLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEINTL
KVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSGRRNRGVYSSSNNQSLLGHAWSL
WNEEKSIELADERMNGQFNSDEVQKCVRVGLLCVQENPDDRPLMSQVLLMLASPDAASLP
TPKQPGFAARRVLMETDTSSTKPDCSVFDSATTIMLEGR
Download sequence
Identical sequences C0P6F5
GRMZM2G322723_P02 GRMZM2G322723_T02|PACid:20825953 NP_001168535.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]