SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G334592_T01|PACid:20841404 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G334592_T01|PACid:20841404
Domain Number 1 Region: 509-820
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-74
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 96-176,207-239
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-18
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  GRMZM2G334592_T01|PACid:20841404
Domain Number - Region: 201-296
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00116
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G334592_T01|PACid:20841404
Sequence length 850
Sequence
MAAALCFASLTRVRPFAAVLLLMLLQQARFRALAVARTNLTAGATLTPADYISSPSGTFS
FGFLALDSDPTKFLLATWFHFADGNASSQFQPQPQPQSVVWFAKQSPSGSTSNATAQSVL
SITSDGQLMLTDGQQVLWTPTTDRGSVLALLDYGNLQFLSDSGNQVLWESFSYPTDTLLP
GQSLSYEPTGSEGKLFARRADAEFTTGRFSMGVQSDGNVVLYVDLLEGNDPENAYWQAYT
NSPDGNTTVTFDGQGRLNYTLHNGTVNSLVKPAASFAAGEYLKFARMDPDGIVRTYVSPK
NGGTGNASWTVSGAFPDYGCVKRTSGLQDMCGPGSYCVSAPTPSSRDRLECTCPSGYKYT
DEQHRDSGCTPGFEPQSCDGENGGSDEFTLVELLNTTWETSIYYKKLSSVTEQQCRDSCL
GDCFCAAALMIGGSKCAEMAALTNGWQANGATSLTTKAFIKVRTRNPPAAAPARNRNALA
YKVAAICLAVVLLVTVGVLVALHCHRRRNRESQRPFSSSVRAFSCKELHQATNGFEKLLG
KGSFGEVYRGTMRSPHPHLIAVKKLITSNEYSEQEFTNEVQSIGQIHHRNLVRMIGYCKE
GKHRMLVFEFMPGGSLRGFLFDPEKRPPWRWRAEAAIAIARGLEYLHYGCSAPIIHCDIK
PDNILLDDRGVPRITDFGISKLLGSQQVHATVTHVRGTRGYIAPEWLRGDARVDTKADVY
SFGVVLLEMICCRRCQEPVALGLPHGAEDDETQTVTLFGWAAQLVGARRTELTLHGDDAD
VDSADDMERVDRFARVALWCIEPNPLLRPTTHQVVQMLETSDWAQVQTLRIPDPPECYME
SSPLIPQLKD
Download sequence
Identical sequences GRMZM2G334592_P01 GRMZM2G334592_T01|PACid:20841404 XP_008659831.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]