SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G364375_T01|PACid:20831134 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G364375_T01|PACid:20831134
Domain Number 1 Region: 530-854
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-79
Family Protein kinases, catalytic subunit 0.0000803
Further Details:      
 
Domain Number 2 Region: 77-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-28
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  GRMZM2G364375_T01|PACid:20831134
Domain Number - Region: 343-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00589
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G364375_T01|PACid:20831134
Sequence length 884
Sequence
MRARTLSLLLHLLAAAASSFTPSASTDTIYRNTTLTGNQTLVSAGGIYALGFFSPAGADG
RTYLGIWYASIPGPTTVVWVANRRDPVANAPAALQLSAGGRLVILDGNNDTVWSTAAPTV
GNVTAAQLLDSGNLVLSADGGGQSVAWQSFDYPTDTLLPGMKLGVDIRAGITRNITAWRS
PSDPSPGDVTFKLVIGGLPQFFLLRGATRVYTSGPWNGEILTGVPYLKAQAFTFEVVYSP
DETYYSYFIREPSLLSRLVVDGAATQLKRFSLNNGAWNSFWYYPTDQCDYYAKCGPFGFC
DTDRSPPCSCLPGFVPRSPDQWGRREWSGGCVRSTSLSCDGGDGFWVVNRMKLPQATDAT
VYAGMTLDQCRQACLGNCSCGAYAAANNSGGIGVGCVIWTVDLLDMRQYPIVVQDVYIRL
AQSEIDALKAAATGDHQHLHKSKLIVVIVATISAVLFLLAAAGCCFFWTKKKKASKKGEG
EDMTSLPPSTADFALPYRVRSQPSLSPVRDHKQLLDASEETRYATDKDVDLPLFELEVIL
AATDNFAGRKRIGAGGFGPVYMEFSRRINAWQGVLEDGQQVAVKRLSQGSTQGVSEFMNE
VRLIAKLQHRNLVRLLGCCIENDERMLVYEYMHNQSLDTFIFDEGKRRLLRWQKRFEIIL
GIARGLQYLHEDSRFRIIHRDLKASNVLLDRNMVPKISDFGIARMFGGDQTTAYTRKVVG
TYGYMAPEYAMDGQISIKSDVFSFGVLVLEIITGRRNRGSYEPDLDVNLLGYAWMLWREG
RSMELLDEALGGSFHHSRALRCIQLALLCVEAQPRNRPLMSSVVTMLASDNAVLPEPSEP
GVNPGIMSASSDTESSRTRSATANYVTVTRLEARSTTSTGHSSL
Download sequence
Identical sequences GRMZM2G364375_T01|PACid:20831134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]