SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G366411_T01|PACid:20820052 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G366411_T01|PACid:20820052
Domain Number 1 Region: 535-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.68e-69
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 94-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-23
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  GRMZM2G366411_T01|PACid:20820052
Domain Number - Region: 378-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000863
Family Pan module (APPLE domain) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G366411_T01|PACid:20820052
Sequence length 858
Sequence
MAALALALALASITLSTLAPRPLPLMTSAFSYTAPHDTIPRKSRLIVEEYKTRILRSSPD
GTFSCGFHQIYDGAFTFSVWYTNSSTDGDDTAAIVWSANRGRPVHAWGAAVALRKDGSMV
LTDYDGTVVWQAQESSSSPDAGAAQYAQLLDTGNLVLKNSSGAIVWQSFDSPTDTFLPTQ
RIAETSRLVSTTELQLPGHYAFRFSDQSILSLIYDDTNVTSVYWPDPDFQYYENSRNLYN
STRIASLGPSGDIFSSDFANSQHELAAADRGAAGILRRLRLDRDGNLRLYSLNSSDGTGT
WSVSWVAESQPCKTHGLCGPYGICHYSPAPVCSCPPGYQMTNPGNWTQGCRPAVDIPCDD
DGEQNLTFLELRNTDYWGSDQERIEKVSLETCKDTCLRDCSCKGVQYQEGNGTCYPKSLL
FNGRSFPTPTVRTMYIKLPSLSLKASKLPIPQSNVLDSSVPHRLRCDPVTSTTIMEKDSH
RRTDQEEPRWIYYFYGFVGAFFVIEVFFFAFAWFFVLRRELRSSQVWAAEEGYKMMTNHF
RMYSYRELAKATEKFTHELGWGGTTYKGVLDDGRAVAVKRLGNIRQHSREEFHDELHVIA
RINHMNLVRMYGFCSERSHRMLVLEYADRGSLADVLFRGRGRGGNNNNSKTSSSLDWKQR
FSVALGVAKGLAYLHHECLEWIVHCNLKPENILLDQDLEPKIADFGLAKLLSRSGSGPAR
NVTPTRARGTVGYIAPEWVSGLPITAKADVYSYGVVLLELVSGTRVFDLVLKGEEDDRAH
AHAVLKKFVRMVSYRLDKDEPFWVAEFVDLRLGGEFDCSQVKGMLRLAVSCLEEERKKRP
TMESVVQSLLSVNSAGSQ
Download sequence
Identical sequences A0A1D6M2E6
GRMZM2G366411_T01|PACid:20820052 GRMZM2G366411_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]