SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G383881_T01|PACid:20877508 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G383881_T01|PACid:20877508
Domain Number 1 Region: 532-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-77
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 115-192,219-244
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.59e-23
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  GRMZM2G383881_T01|PACid:20877508
Domain Number - Region: 415-454
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Pan module (APPLE domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G383881_T01|PACid:20877508
Sequence length 825
Sequence
MPSPRTHRPAMPRAERLLLLLMLSIPFSHAWSIDYPSPIANLPSTWANNKATIPYNATYA
DGSAIRAILVRQKPAGFGPSFGCGFICATAPCKGFLFAVFFMSTGDPVFNASATPPRIIW
TANRYRPVKENASLQFSKDGDLVLRDLDGSLVWSTATSGSSVVGMNLAETGNLILFDVMG
KTVWESFAHPTDTLLIGQSLWQGKRLSSTASTETNSTQGQFYLTLLGTGLYAFTDDADPP
QLYYQKGFNVTDAILVQSKRNVSSDQAKNSTAYVSFLQGSFSAFLSFNSTAIKLFDISLP
LPSSAQFMSLEDDGHLRVYGWDGASWRALADVLHVYPDECAYPTVCVAYGICSQGQCSCP
GGSDDDDELFRQLDDRKPNLGCSLATPLSCDLIQYHKLIALPNVTYFSLANNNWTWTTDE
ESCKEACLKTCSCKAVFFQHQGDVSNGSCHLVPEIFSLMNYHPEVAGYNLSAYVKVQMLP
PPPSSSKGINATAYHVGVPVLVAVICILILMVRRTVVKSLGLQEDDDPFKGVSGTPTRFS
YRQLREATDNFSRKLGQGGFGPVYEGKLGNAKIAVKCLRDIGHGKEEFMAEVVTIGSIHH
INLVRLIGYCSDKFHRLLVYEHMSNGSLDRWIFRKNQSGSLSWAARYKIILDIAKGLAYL
HEECRQKIAHLDIKPGNILLDDRFDAKISDFGLAKLIDRDQSHVMTKIRGTRGYLAPEWL
SSTITEKADIYSFGVVVLEIVSGRKNLENNQPEGSPNLVNILQEKMKAGRALDIVDDQDE
DLQLHGSEMAEVIKLAVWCLQRDCSKRPAMSQVVKVLEVGRCHGH
Download sequence
Identical sequences XP_020394083.1.34533 GRMZM2G383881_P01 GRMZM2G383881_T01|PACid:20877508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]