SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G399087_T01|PACid:20835848 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G399087_T01|PACid:20835848
Domain Number 1 Region: 363-643,674-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.76e-67
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 32-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-62
Family Legume lectins 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G399087_T01|PACid:20835848
Sequence length 758
Sequence
MAVMSSGGLLPTLCCLCYVLSSVHVPLAASLSFHFNFSDPDSTCTAQNAELACSSDAYFH
STEDAIELTKNGMDNHNNKSVGRLVYTQPIPLWNGATGELASFTTSFTFRIKRAQPGSPS
GDGMAFFLAHHPGRVPPSSFGRNLGLFNDSTNRNATGDDRAVAVEFDTFENDELEDADGN
HVGIDVNSIVSTDSISPDKSIKSGETLAADVAFDNTTETLSVTLWMSGAPYRVSANVDMR
KSLPQMVAVGFAASTGNNVEMHQLLSWSFNSTLASSKDGETRPPAPSQAIVSKNKSKARS
SAIAVSSAAAFVVVCALTGFLLRRKLRMWKTSKEASGAGELDDDEHDGEEAEFEKGVGPK
RYSYRELAAATRNFSEETKLGRGGFGHVYQGRLNIDGQDRRVAIKKFSESSMQGRKEFEA
EVKIISRLRHRNLVRLIGWCDCCKGLLIVYELVSEGSLDRHIYNAARWLTWPQRGEAISQ
IVWQKQLIVKSKSFPCIKVPETAKMALAFKCFSQYKIIIGLGSALRYLHAEWEQCVVHGD
IKPSNIMLDSSLDAKLGDFGLARLVDHGVKPATTKVVLGTAGYIDPELVNTRRPSAVSDV
YSFGVVLLELVTGRRPVEEPDDSDELFVLIRWVWRLYGRNAIAEAVDERLKLVGREGDGG
GGEVEEEEERGQMERALVVGLWCAQPDRGDRPSIAHAMHVLQSADVKLPVLRPHMYASAA
DTVHSTIAMGGDGYSELSFGVTSTDGSDTSTTSERESK
Download sequence
Identical sequences GRMZM2G399087_T01|PACid:20835848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]