SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G399901_T01|PACid:20878705 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G399901_T01|PACid:20878705
Domain Number 1 Region: 363-440
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000197
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 167-189
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000968
Family CCCH zinc finger 0.0049
Further Details:      
 
Weak hits

Sequence:  GRMZM2G399901_T01|PACid:20878705
Domain Number - Region: 194-216
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000746
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00235
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 303-331
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0222
Family CCCH zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G399901_T01|PACid:20878705
Sequence length 528
Sequence
MRKFGKEALSQCYLDILVHVLRQRTPVHHLRPQQDGLKQKQRRLPTQSGGNMVPAFQASL
RRAQFTLLPEIPPLAMPRRWGPNSHSASLPFLGKPIPRFGAHHKADLRKREEDERDRTKL
RAAPTDQTLGVRRASPRRRRKGASRRLGVPEVVDGAARSASSSMSRRVPCKFFLHGACFK
GDYCEFSHDCNDQPDNVCTFYQKGTCTFGSRCRNEHVEVHCNCPQPATTVARASSNSSQL
VASSRDPHCSECQTDLCDQTQQICKSTAALSAHQPAWVVDYHDHDTPDDTTSWPLHQAVQ
NQTSQYPVHLPICSSTADGTCPYGKGCSQMHGDLCAFCERQCMNPYQSDERGVHVKLCKK
NNRVLEAMRRSEDIECGVCLDRVLSKPTAAERRFGLLSDCDHSFCISCIRNWRSTSPTSG
MDVNSTLRACPICRKLSYYVVPSITWYSSKEEKQEIVEGYKAKLRSIDCKHFDFGKGTCP
FGSSCFYKHAYDDGRLEDALLNHHDADDASAAIAKLMRLSYLLTRLHV
Download sequence
Identical sequences GRMZM2G399901_T01|PACid:20878705 GRMZM2G399901_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]