SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G401606_T01|PACid:20827437 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G401606_T01|PACid:20827437
Domain Number 1 Region: 513-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-73
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 64-172,204-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-22
Family alpha-D-mannose-specific plant lectins 0.0076
Further Details:      
 
Weak hits

Sequence:  GRMZM2G401606_T01|PACid:20827437
Domain Number - Region: 376-435
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G401606_T01|PACid:20827437
Sequence length 861
Sequence
MSVALPIAVVGLLALVGACRSAATDTLSPRQVLAGNDTLVSNNSKFTLGFFKAPDGAAGS
ADKWYLGIWFTAVPGRTTVWVANGANPIIEPDTGSPELAVTGDGDLAVVNNATKLVTWSA
RPAHDANTTTAAAVAVLLNSGNLVLLDASNSSSTAAAAPRRTLWQSFDHPTDTLLPSAKL
GLNRATGASSRLVSRLSSATPSPGPYCFEVDPVAPQLVLRLCDSSPVTTYWATGAWNGRY
FSNIPEMAGDVPNFHLAFVDDASEEYLQFNVTTEATVTRNFVDVTGQNKHQVWLGASKGW
LTLYAGPKAQCDVYAACGPFTVCSYTAVQLCSCMKGFSVRSPMDWEQGDRTGGCVRDAPL
DCSTGNNSNASAPSSTSDGFFSMPSIGLPDNGRTLQNARSSAECSTACLTNCSCTAYSYG
GSQGCLVWQGGLLDAKQPQSNDADYVSDVETLHLRLAATEFQTSGRRKRGVTIGAVTGAC
AAALVLLALAVAVIIRRRKKTKNGRGAAAGGGLTAFSYRELRSATKNFSEKLGQGGFGSV
FKGQLRDSTGVAVKRLDGSFQGEKQFRAEVSSIGVIQHVNLVRLVGFCCEGERRFLVYEH
MPNRSLDIHLFQSGGGVFLDWSTRYQIAVGVARGLSYLHDGCRDRIIHCDVKPENILLGA
SLLPKIADFGMAKFVGRDFSRVLTTMRGTKGYLAPEWIGGTAITPKVDVYSYGMVLLELV
SGRRNAGEQYCTASGSGDDDAAREELAFFPMEAARELVKGPGVVSVSSLLDGKLCGDADL
VEVERACKVACWCIQDDEADRPTMGEVVQILEGVLDCDMPPLPRLLETIFGRPHSSTEQQ
TTTVSGTSTSQPFTSGSGSHN
Download sequence
Identical sequences A0A1D6ML66
XP_008675699.1.34533 GRMZM2G401606_T01|PACid:20827437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]