SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G403789_T01|PACid:20873408 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G403789_T01|PACid:20873408
Domain Number 1 Region: 63-163,195-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-26
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Weak hits

Sequence:  GRMZM2G403789_T01|PACid:20873408
Domain Number - Region: 373-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Hairpin loop containing domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G403789_T01|PACid:20873408
Sequence length 430
Sequence
MAYLHILIVLLSSLHLILGNHATTTRDTISAGQPLRIHDKLVSQNGRYALGFFEAGSSQN
TSNWYLGIWFNSIPKFTVGWVANRDAPMKNHTSLELKISHDGNLVVANRATDSIVWSTEV
NMNYRNNTIIAVLLNSSNLVLRDDDASNSSSISIWQSFDHPTDSLFQWAKLGWDNATGLN
RRLVSKKNSISPASGLYREELDPSGVNQVVLASLIRSTKPYWASGAWNGNRFNSSPEVSR
NVGFLSFVETTHEKYHTYHVSDEVDVYYNLGVSGQVKVFVWPQGSQDWVLAHAEPRSPCD
VYAACGPYTVCDDGALPHCTCMKGFTVTSVEDWELDDRSSGCSRNTALDCNLSGESSVRS
MDKFLSVPCVSFGQSEHKTDGAKSSGECAQVCLRNCSCTAYSFSNDTCLVWHQELLNIRQ
IQCGAAADSN
Download sequence
Identical sequences GRMZM2G403789_T01|PACid:20873408 GRMZM2G403789_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]