SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G413030_T01|PACid:20834190 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G413030_T01|PACid:20834190
Domain Number 1 Region: 521-810
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 100-196,228-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-28
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  GRMZM2G413030_T01|PACid:20834190
Domain Number - Region: 388-441
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00863
Family Pan module (APPLE domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G413030_T01|PACid:20834190
Sequence length 833
Sequence
MSEPEDPSVSTNRTPLRSPACSLPTPQLVSSIAMPRPPLHVLLLLLLSLRAAPCPCSAAT
TDTLSPGNGLAGTAATARLVSNNSKFALGFFKTDSKSPNTYLGIWFNKVPKLTPLWSANG
ESPVVDPATPELAISGDGNLVIRDQATGSVVWSTRANITSNNTTTVAVLLSSGNLVLRSS
SNASDVFWQSFDYPTDTLFAGAKIGWNKRTGLNRRLVSRKNALDQAPGLYSLEMTESNGV
GHLLWNSTVAYWSSGQWNGNYFGLAPEMIGAVMPNFRFVNTDEEIYFTYTLHDDAAIVHS
ALDVSGRGLVGFWLDSKQDWLINYRQPVAQCDVYATCGPFTICDDDADPTCSCMKGFSVR
SPRDWELGDRRDGCARNTQLDCASDTGLTDRFFAVQGVRLPQDANKMQAATSGDECSGIC
LRDCSCTAYSYWNGDCSVWRGKLYNVKQQSDASSRGDGETLYIRLAAKEVAMQKRGISVG
VAVGVAIGATAAASILLAGLMIRRRKAKWFPRTLQDAQAGIGIIAFRYADLQRATRNFSE
RLGGGSFGSVFKGCYLGDPVTLLAVKRLDGAHQGEKQFRAEVNSVGIIQHINLVRLIGFC
CEDDKRLLVYEYMPNHSLDLHLFKANGTVLDWNLRYQIAIGVARGLTYLHTSCRDCIIHC
DIKPENILLDASFVPKIADFGMAKVLGREFSHAVTTMRGTIGYLAPEWISGTAVTSKVDV
YSYGMVLFEVISGRKNSSPEYFGDGDYSSFFPMQVARKLRSGHVESLVDEKLQGDVNLKE
VERVCKAACWCIQENESARPTMAEVVQFLEGLSDLGMPPLPRLLNAVTGGSPT
Download sequence
Identical sequences GRMZM2G413030_P01 GRMZM2G413030_T01|PACid:20834190 XP_008653077.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]