SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G418956_T01|PACid:20838584 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G418956_T01|PACid:20838584
Domain Number 1 Region: 505-806
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 65-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.3e-25
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  GRMZM2G418956_T01|PACid:20838584
Domain Number - Region: 338-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000471
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G418956_T01|PACid:20838584
Sequence length 820
Sequence
MNESSAAASSYLLLTLIIHLLPFVSAHDFLSAGSSLSVEHSSDVLHSQDGTFTCGFYRIS
PNASTFSIWFSGSSERTVVWSANPLHPVYTWGSKVELDADGSMVLKDYNGQIVWTNNASV
SDAGHVQARLLGTGNLAVEGRGGAILWQSFDSPTDTLLPTQRITASTKLVSTNRLLVPGH
YSFRFDDQYLLSLFDDEKNISFIYWPNPRMTIWAKGRVQFNSTMSGALDTLGHFLASDNA
TFTAADWGPGIMRRLTLDYDGNLRLYSLNVADRTWSVTWMAFPQLCNVHGLCGENGICVY
TPVPACACAPGFEVIDPSERSKGCRPKTNISCDVEKVDFAKLPHTDFLGYDMTAHHSVSL
DFCKKECLHDCNCKGFAYWEGIGDCYPKSVLVGGVTLQNFASTGTMYIKIPNGLQVLDAS
IPQSQPFGPKYSPDCGTTNRYFIADFLDKLKRDHSGSKYLYFYGFLSAIFLAEVVFVGLG
WFILRREYRELRGVWPAEPGYEMIANHFRRYAYRELVTATRKFKDELGRGASGIVYKGVL
EDKGAVAVKKLAEINQSEEEFRHELSVISMINHMNLVRVWGYCSDGPHRILVSECFENGS
LDKILFGSKGSEILLGWKQRFDIALGVARGLAYLHHECSEWVIHCDVKPENILLDENLVP
KIADFGLAKLLNRGRSNLNVSKIQGTRGYLAPEWVSSLPITAKVDVYSFGVVLLELLIGA
RVSNMGNDEDVEAEMVLGRVSRLVKEKLQSDDTEPSWIADFIDSRLNGDFNNLQARIMMR
LSISCLEEDRDRRPTMENAVQILVLTEDVSGANVMKKFSL
Download sequence
Identical sequences GRMZM2G418956_T01|PACid:20838584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]