SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G422340_T01|PACid:20842568 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G422340_T01|PACid:20842568
Domain Number 1 Region: 500-820
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-82
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 56-150,181-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-25
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  GRMZM2G422340_T01|PACid:20842568
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0216
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G422340_T01|PACid:20842568
Sequence length 832
Sequence
MAMAYLPVFVFLFMVVLCQSDDRLTPAKPLLPNEVLISGGGVFALGFFSLKNSSRSYVGI
WYNNIPERTYVWIANRDNPITTNVPGKLVFTNSSDLVLLDSTGRTIWTTTNNYTAGGGGE
TASILLDSGNLVIRLPNGTDIWESFSYPTDTIVPNVNFSLNVASSATLLVAWKGPDDPSS
SDFSMGGDPSSGLQIIVWNGTQPYWRRAAWGGELVHGIFQNNTSFMMYQTVVDTGDGYYM
QLTVPDGSPSIRLTLDYTGMSTFRRWNNNTSSWKIFSQFPYPSCDRYASCGPFGYCDDTV
PVPACKCLDGFEPNGLDSSKGCRRKDELKCGDGDSFFTLPSMKTPDKFLYIKNRSLDQCA
AECRDNCSCTAYAYANLQNVDTTIDTTRCLVSIMHSAASIGLNSRQRPSNVCKNKKSTTL
KIVLPIMAGLILLITCTWLVFKPKGRTLLHFSECSVNEVLIKTRLISMCPFLPDKHKSKK
SQYTLQHSDASNRFENENLEFPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKE
VAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLDCCIHKDEKLLIYEYLPNKSLDAF
LFDATRKSLLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDF
GMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTYSFGVLLLEIVSGLKIGSP
HLIMDYPNLIAYAWSLWEGGNARELVDSSVLVSCPLQEAVRCIHLGLLCVQDSPNARPLM
SSIVFMLENETAPVPTPKRPVYFTTRNYETNQSDQYMRRSLNNMSITTLEGR
Download sequence
Identical sequences GRMZM2G422340_P01 GRMZM2G422340_T01|PACid:20842568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]