SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G461537_T01|PACid:20856757 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G461537_T01|PACid:20856757
Domain Number 1 Region: 107-187,252-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000183
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  GRMZM2G461537_T01|PACid:20856757
Domain Number - Region: 397-433
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000746
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G461537_T01|PACid:20856757
Sequence length 536
Sequence
MMLLVVVIEENGCQFETIINREGRTRLLLRACSRIRWGYRPPIANMEAIARPWHRSCGKV
SPSLTTSSYSQFQPVLADPTGVFALGFLRVNSTMLDLAIVHLPSTFPLWRAIPDRPAPWS
TAASLSFDGGLVLTDRAADKVLWSTAATSASAGDRAVLLNTSNLQIQSTGGSSSPDVVWQ
SFDYPPKTIVQGQNFTSATKLYSFDRRFAMRLGSNYFGLHIEPPPSSGGVAAAMYFKHMA
MEAKAQIVAGGGPTYARVEPDGFPAMYQREGPPADVLSFDTFNRGVRALRRMTLEPNRNL
RAYYWNGARWALDYTAINDNDRCELPTTYGAYIVCAEPSGSCECLANATDGSGYAAAVPA
SFASNLCGTTGGEVGGLYWAVRRWGVEPVNKELLRSEQAASTTDCEARCEHNCSCWGAVY
SNRTGVCYVMDYPAQLLVASDDRKMGYFKIMSLEEEGTRGRGDGRTSGVKAALLVVGVVS
VVTAAAFGAYRVWDRRRRSAVDARRQMGAADDGLSPGPYKNLGSFSSVELTNSFRR
Download sequence
Identical sequences GRMZM2G461537_T01|PACid:20856757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]