SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G470694_T01|PACid:20846506 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G470694_T01|PACid:20846506
Domain Number 1 Region: 519-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.84e-26
Family Protein kinases, catalytic subunit 0.0058
Further Details:      
 
Domain Number 2 Region: 77-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-24
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G470694_T01|PACid:20846506
Sequence length 722
Sequence
MTRLLCLTALTIFPIILCLTTSAAVTASDTLDSGSNITDGATLVSAGGSFTLGFFSPTGV
PTKRYLGIWFTASPEAICWVANRETFLSNTSGGVLVIGSTGSLRLLDGSGRTAWSSVDST
SSSAPPVVAQAQLLESGNLVVRDQSGRDVLWQSFDHPSNTLLAGMRFGKDPRTGAEWFLT
SWRASNDPTPGGYRRVLDTRGGLLDSVSWKGSVKKYRTGPWNGLWFSGIPETASYKDMYS
TQLVVRPDEIAYVFNTAAGAPFCRLVLNEVGMVQQLGWDPVSRVWNVFTQAPRDVCDNYA
KCGAFGLCDVKSGSTLFCSCAVGFSPVNPSQWSMRETRGGCRRNVPLECGNGTTTDGFKM
VRAVKLPDTDNATVDMGATLEQCRARCLANCSCVAYAAADIRGGGGGHGCVMWTDAIVDV
RYVGKGQDIYLRLAKSELVEKKRNVVIIILPLVTACLLALMGMLLVWIWRKHKLRGKRRS
MDDIQHKTIVRHLDETNTLGDENLDLPFFSFGDIGILGEDRVVAIKRLSQGSGQGIDEFR
NEVVLIAKLQHRNLVRLLGCCIHGDEKLLVYEYLPNKSLDSFIFAFSVMSDTYSLGVILL
EIVSGLKITSTHSTSFPSLLAYAWSLWNGGRAMDLVDSSLLESCSASEAMRCIHIGLLCV
QDNPNSRPLMSTVVFMLENETTLLSIPKQPLCFSQWYLEAQATGENTNSSMNSTSVSVLE
GR
Download sequence
Identical sequences GRMZM2G470694_P01 GRMZM2G470694_T01|PACid:20846506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]