SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G472655_T01|PACid:20853055 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G472655_T01|PACid:20853055
Domain Number 1 Region: 573-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-74
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 142-219,246-270
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-25
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G472655_T01|PACid:20853055
Sequence length 905
Sequence
MPTHARFPNRFGDPDGDANPMPPSHRLSLLLAVAVVVAATSVRVHVHAQGSVLFPTPAST
NVSVTWTVSLKADGHGAQSFDYMDGTSASVFLLQSVHPTPQEGLCFAACFYCVAPCRAFL
FGVCVVYVDGGGFLSWPNAGSPQVVWSANRGRLVRENATLSLTAAGDLLLRDGGGGGVVW
STNTSGRSVAGMAVTRSGNLVLLDGKNAAVWQSFDHPTDSLLPGQPLVEGMRLAPNASST
NWTASGQLYITVLSDGLYAFAESSPPQLYYQMTVTTNTTAGPGGRKTYMALTNGSLAIFA
PSSSVNVSTPQPADGATNKTAAGEMEYVRLESDGHLKLYRYTGTEGWAMAQDLLQGQVGS
CAYPTVCGAYGVCVSGQCTCPSATYFRQVDDRRTDLGCVPVAPISCASTQDHRLLALSNV
SYFNYVDTKAALPRMVDEESCKKACLQNCSCKAAFFQYGGNDTSQGSCYLPTQVFSMQVN
QWQETHYSSSAYLKVQVTRSPPPPPVPGPSNSNGTAIPAGKGRTGEAAIVGSALAGAIAL
LAVIVVTSVVLRRRYRRRDDEDDEDGLGEVPGMMTTRFTFEQLRAATEQFSKMIGKGGFG
SVFEGQVGDQRVAVKQLDRTGQGRREFLAEVETIGNIHHINLVTLVGFCAERSHRLLVYE
YMPNGSLDRWIYSSAAAAADTTPLDWHTRRRVITDVARGLAYLHEECRQRIAHLDIKPQN
ILLDDGFGAKISDFGLSKMIGRDESRVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVV
MEVVSGRKNLDYSQPEDSVHLISVLQEKARDGRLEDLVDARSDEMRGLHREGVIQMVKLA
MWCLQVDYNRRPQMSVVVKVLDGAVDVETGIELNFVATVPDSLANNGGNLASSTPLLASH
LSGPR
Download sequence
Identical sequences XP_008655751.1.34533 GRMZM2G472655_T01|PACid:20853055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]