SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G556078_T01|PACid:20865672 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G556078_T01|PACid:20865672
Domain Number 1 Region: 107-164,229-250
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000072
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G556078_T01|PACid:20865672
Sequence length 355
Sequence
MGLQTTDCEHGSNSTGVVRGCGGAYIFFDRRRRRRDRGAGAAARSLRRSRPVLLAVPAGA
RRPHGCLRARLPPCQLHHAGPCRRPPPVCLPTLACDPRPPRAMVYSGLVHTDRAADKVLW
STAATSASAGDRAVLLNTSNLQIQSTGGSSSPDVVWQSFDYPSETIIQGQNFTSAATLYS
FDRRFAMRLGSNYFDLYIEPPPSSGGVAAAMYFKHTAMEAKAQIVADGGPTYARVEPNGF
LAMYQREGPPADVLSFDTFNRGVRALRRMTLEPNGYLRAYYWNGTRWALNYTAINDNDRC
ELPTTCGAYSVCTEPSGSCECLANATDGSDCVAAMPTSVASSLCGTTGGEVGGLY
Download sequence
Identical sequences GRMZM2G556078_T01|PACid:20865672 GRMZM2G556078_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]