SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000000993 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000000993
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 3 Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000787
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000000993
Domain Number - Region: 473-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000000993   Gene: ENSETEG00000001228   Transcript: ENSETET00000001229
Sequence length 543
Comment pep:novel genescaffold:TENREC:GeneScaffold_5765:7548:385994:1 gene:ENSETEG00000001228 transcript:ENSETET00000001229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPFPLVWGHYDVCMTQIYTDEGKVWDYMACQPESMDMTKY
LKVKLDPPDITCGDPPETFCAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCDPHCAS
XXXCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKAGTTGPKCDECLPGNSWHSGCQPNVCDNELLHCQNGGTC
HNNVRCQCPEAYTGILCEKLRCQEAGSCGADSGQAALRPASAEPGLLLLPLAALLGTAGP
LAI
Download sequence
Identical sequences ENSETEP00000000993 ENSETEP00000000993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]