SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000002209 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000002209
Domain Number 1 Region: 36-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-36
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 226-259
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000327
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000002209   Gene: ENSETEG00000002710   Transcript: ENSETET00000002707
Sequence length 548
Comment pep:novel scaffold:TENREC:scaffold_287557:2581:9332:1 gene:ENSETEG00000002710 transcript:ENSETET00000002707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKERPGMAEEPQQHVSSAPVVKLEKELPWGKGREDLSPETFRLKFRQFRYQEAAGPQEA
LRELQELCRQWLRPELHTKEQILELLVLEQFLTILPPEFYAWIREHCPESSKALVAMMED
MTERALEAKAVPCHVQGEQEETALCRSPWEPSVHLGPVEVKPEWGLPPREGVPGLHQSTE
EQLTRDPRDGPQAFQEQALPLLQAGPGLPSVNPRDPGMAAGFLTAGSQALGPFKDMALAF
PEEEWRHVTPAQIDCFGEYVEPEDCGVSSPGIGSKEKEAKTQQEDLKGSLAGLTSERFED
AVLQSPEFGRTCDQEPSSSLGHLPGLPAPQHGVMPLPDDLKTHSPFWKPFQCPECGKGFS
RSSNLVRHQRTHEEEKSFGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHH
LEVHQRSHTGEKPYKCTDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHR
RAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQH
RQEPPVEK
Download sequence
Identical sequences ENSETEP00000002209 ENSETEP00000002209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]