SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000006648 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000006648
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-43
Family Dual specificity phosphatase-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000006648   Gene: ENSETEG00000008183   Transcript: ENSETET00000008183
Sequence length 173
Comment pep:novel scaffold:TENREC:scaffold_297294:4664:9191:1 gene:ENSETEG00000008183 transcript:ENSETET00000008183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTALVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences A0A2I3GRY3 A0A2K6F4L2 H2PJH1
ENSETEP00000006648 ENSNLEP00000000527 XP_003276039.1.23891 XP_004696385.1.18182 XP_007955114.1.48129 XP_012358293.1.23891 XP_012358294.1.23891 XP_012505733.1.63892 XP_021505510.1.76796 ENSPPYP00000018734 9600.ENSPPYP00000018734 ENSPPYP00000018734 ENSETEP00000006648 ENSNLEP00000000527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]