SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000009910 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000009910
Domain Number 1 Region: 169-267
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-33
Family Ras-binding domain, RBD 0.0027
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000009910
Domain Number - Region: 129-228
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000009910   Gene: ENSETEG00000012216   Transcript: ENSETET00000012216
Sequence length 491
Comment pep:novel genescaffold:TENREC:GeneScaffold_782:97948:214007:1 gene:ENSETEG00000012216 transcript:ENSETET00000012216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNDDIDQMFSNLLGEMDLLTQSLGVETLPPPETRTTRTEFNYTVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKASAQNPPHLAPREASHFSGAAFLGSEADAPAAR
ISYCEDAFPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLVRDVLDNLFEKTHCDCNVDWCLYEIYPELQIERIFEDHENV
VEVLSDWTRDTENKILFLEKGEKYGVFKNPQNFYLDNRGKKDSKETNEKMNAKNKESLLE
ESFCGTSVIVPEIEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGLQCKVKYKAPTDCCFVLKHPQIQKESQYIKYLCCDDARTLSQWVTGIRIAKYG
KTLYDNYQRAVAKAGLASRWTNLGTVSPAIPAQPPAGRKPSPAQPNGQVPQAAHSVSAVL
SGAQKQAEMTK
Download sequence
Identical sequences ENSETEP00000009910 ENSETEP00000009910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]