SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000011060 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000011060
Domain Number 1 Region: 299-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 464-521
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000000131
Family Frizzled cysteine-rich domain 0.0041
Further Details:      
 
Domain Number 3 Region: 257-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 213-252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000314
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000011060
Domain Number - Region: 420-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00209
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000011060   Gene: ENSETEG00000013636   Transcript: ENSETET00000013636
Sequence length 522
Comment pep:novel genescaffold:TENREC:GeneScaffold_7783:3:5680:-1 gene:ENSETEG00000013636 transcript:ENSETET00000013636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTSDVILCVEATEQSKTEFCNPAFEADLGSPSPLPAFQEDGSSLRDPWRGRSSQGLRP
DCYFSGLCVLLLSAVLLLLLGLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCGKMPPPTLNTNASHLRVAFVSDSSV
QGLGFHAWYQAVAPGHGNCAHDEFSCDQILCLLPDSVCDGFANCADGSDEANCGAKFPGC
GGNLTGLQGTFSAPTLLQRSPHQQLCTWHLTVPEGHGIALQFHNFSLEAHGECKLDYVDV
YESGHSGALRFLGRFCGAEPPPRLVSSHHTLAVLFRTDPGFSSGGFSATYQALNATSKPC
RPELPCEDETCEALQWACDVWRDCTQGGSAGNCTRALPPPTELACEPVQVEMCIGLSYNA
TAFPNIWVGMATQEEVMEILGGYKSLTSLPCYQNFRRLLCGL
Download sequence
Identical sequences ENSETEP00000011060 ENSETEP00000011060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]