SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000015297 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000015297
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-31
Family DBL homology domain (DH-domain) 0.00000198
Further Details:      
 
Domain Number 2 Region: 352-472
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-22
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 3 Region: 569-672
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-16
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 716-766
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000499
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 520-594
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000112
Family SH3-domain 0.00047
Further Details:      
 
Domain Number 6 Region: 1-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000013
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000015297   Gene: ENSETEG00000018829   Transcript: ENSETET00000018829
Sequence length 766
Comment pep:novel genescaffold:TENREC:GeneScaffold_3677:776:370693:-1 gene:ENSETEG00000018829 transcript:ENSETET00000018829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIXX
XXXXXXXXXXXXXXXXXXXXXETRAEDEEGLYDCVYGEDEGGEVYEDLMKAEEAHQPKCP
ENDIRSCCLTEIKQTEEKYTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELVKIHRNL
MQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTREDVKLKLEE
CSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDSTEKANLKLALDAMKXXXXXX
XXXXXDNETLREIKQFQLSIENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHIFLFDLA
VIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKETKKWSYGFYLIHIQGQNGLEFYCKTKD
LKKKWLEQFDMALSNIRPDHADANSHDFKMHTFTRVTACKVCQMLLRGTFYQGYLCFKCG
ARAHKECLGRVDNCGRLNSGEQGTLKPPEKRANGLRXXXXXXXXXLPKMQVIRNYTGTPP
PALHEGPPLHIQAGDTVELLRGDAHSLFWQGRNFASGEVGFFPSDAVRPCPCXXXXXXXX
XXXXYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFF
HIAENRKFKSLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSPK
VLGIAVARYDFCARDMRELSLLKGEVVKIYTKMSANGWWRGEVNGR
Download sequence
Identical sequences ENSETEP00000015297 ENSETEP00000015297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]