SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000016361 from Echinops telfairi 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000016361
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.17e-38
Family SCAN domain 0.0000542
Further Details:      
 
Domain Number 2 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 400-442,471-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 587-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-17
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 227-288
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000641
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 6 Region: 526-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000474
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000016361   Gene: ENSETEG00000020138   Transcript: ENSETET00000020138
Sequence length 643
Comment pep:novel scaffold:TENREC:scaffold_303413:76197:81146:-1 gene:ENSETEG00000020138 transcript:ENSETET00000020138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATILEPEDQDLWEEEGILMVKLEDDFTCRPESVLEGNDPVFETSHQNFRRFRYQEAASP
RDALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTIHVHDQEVLSEELVHLGAELESPNEVQDPVQTSTPLEVHEETTQ
IPDLGAPEEQSPCPEEEFQPLQERGAPVRQDPDPPEERNTGDSLLTALSQGLVTFKDVAV
CFSQDQWNDVDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLNEISQVREEEFWVQDIQEPQ
EPQETEILSFTYTGEQSEDDEYLEQEDRSLEDFQRSVLGDPEIHQTPDWEIVFEDNSGRL
NERRFDTNISQVNSLTNLQETIPLHPLLGRHHHCTVCGKSFTCNSHLVRHLRTHTGEKPY
KCMECGKSYTRSSHLARHQKIHKIGVSYKLPLNRKNVNETSSVIQVEKTPSIEKPHRCDD
CGKYFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRVHLGDKPYLCAECGED
FHDHRQYLAHRKTHAPEELFLCSECGQCFNHNATFAKHLKGHASVRSCRCGECGKSFSRR
DHLVRHQRTHTGEKPFMCPTCGKHFSRGYHLIRHQRTHSEKTP
Download sequence
Identical sequences ENSETEP00000016361 XP_004713975.1.18182 ENSETEP00000016361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]