SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000068 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000068
Domain Number 1 Region: 19-117,169-273,356-395
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.83e-31
Family WD40-repeat 0.003
Further Details:      
 
Domain Number 2 Region: 283-372
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.6e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000068   Gene: ENSEEUG00000000078   Transcript: ENSEEUT00000000078
Sequence length 400
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4367:311:123117:1 gene:ENSEEUG00000000078 transcript:ENSEEUT00000000078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEIQPKPLIRKPILLQRVEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYW
PSIYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDVETRHVFIGDHSGQVT
ILKLEQENCTLVTTFRGHTGGVTALCWDPIQRVLFSGSSDHSVIMWDIGGRKGTAIELQG
HNDKVQALSYAQHTRQLISCGGDGGIVIWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ
MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFAVRVCDSCHEAITDEERAPTA
TFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Download sequence
Identical sequences ENSEEUP00000000068 ENSEEUP00000000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]