SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000150 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000150
Domain Number 1 Region: 53-115
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-22
Family SH3-domain 0.00048
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000171
Family SH2 domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000150   Gene: ENSEEUG00000000176   Transcript: ENSEEUT00000000175
Sequence length 117
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5394:54075:55637:-1 gene:ENSEEUG00000000176 transcript:ENSEEUT00000000175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGDQVQHFKVLREATGKYFLWEKKFNSLNELLDFYRTTTIARKGQVFLRDQEPLLKPPRT
CFAQAQFDFLAQDASQLSLRRGDIVEVLDGLDPHWWHGRLRGHSGYFPRSYVQPMHL
Download sequence
Identical sequences ENSEEUP00000000150 ENSEEUP00000000150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]