SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000154 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000154
Domain Number 1 Region: 1383-1495
Classification Level Classification E-value
Superfamily Bromodomain 9.68e-33
Family Bromodomain 0.00019
Further Details:      
 
Domain Number 2 Region: 1098-1164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.2e-19
Family PHD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000154   Gene: ENSEEUG00000000179   Transcript: ENSEEUT00000000179
Sequence length 1519
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8517:5217:59767:-1 gene:ENSEEUG00000000179 transcript:ENSEEUT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQSFPEPLVIPVLYLTNLTHR
SRLHEICDDIYAYVKDRYFVAETVEVIRNNGARLQCRILEVLPPSHQNGFTNGHFSSAEG
ETIIISDSDDSETQNSAFQNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXPSTLSTYKITEQDFSYFFPDDPPTFIFSPPNRRRGR
PPKRLSVNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFEKAKLKREKADAQEAK
KKEKEDKEKKKEELKKIVEEERLKKKEEKERLKIEREKEREKLREEKRKYMEYLKQWSKP
REDMECDDLKDLPEPTPVKTRLPPEIFGDALMVLEFLNAFGELFDLQDEFPEGVTLGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTEALDEDADPTK
SALSAVASLAAAWPQLHQGCSLKSLDLDSCTLSEILRLHILASGADVTSANAKYRYQKRG
GFDATDDACMELRLSNPSLVKKLSSTSVYDLTPGEKMKILHALCEKLLTLVSTRDFIEDY
VDILRQTKQEFRELKAEQHRKERQEAAARIRKKKEEKLKEQEQKMKEKQEKLKVDEQRNS
AAETSVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKPQTDSKPTHSRGRSSNVDDPSQMSAEKQLELRLRDFLLDIEDRIYQGTLGA
IKVSDRHIWRSALESGRYELLSEENKENGIIKPVNEGVEEMETDEQAKVVVKDRLLGIKS
ETPSTVSTNASTPQSVSNVVHHLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWR
ESLLSSASLSQVFLHLSTLDRSVIWSKSILNARCKMCRKKGDAENMVLCDGCDRGHHTYC
VRPKLKTVPEGDWFCPECRPKQRSRRLSSRQRPSLDSDEELEDHVEDEDEVDDDDEEGQS
EVEEYEIEQDEEYSQEEEEVSPPKRGKPQVRLPIKTRGRLTSSFSSRGQRQDPGRCSSRS
QPSTPKTSATSKSTGRNLRKIKSAPSTETKPVRNASRSTRQSRAPLQADVSVELLSPPRK
RRGRKSANSTPENSPNLSNFRIIATTSGEQARSLNVASKLSLQDNESTRRGGKRQSTELS
PVTLNRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKVQVPDYYDIIKKPIALN
IIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHV
TPGNVDQVSTPPAAKKSRI
Download sequence
Identical sequences ENSEEUP00000000154 ENSEEUP00000000154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]