SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000187 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000187
Domain Number 1 Region: 476-586
Classification Level Classification E-value
Superfamily Bromodomain 5.89e-29
Family Bromodomain 0.00045
Further Details:      
 
Domain Number 2 Region: 109-186
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.13e-18
Family PHD domain 0.0095
Further Details:      
 
Domain Number 3 Region: 940-1045
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-17
Family PWWP domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000187
Domain Number - Region: 224-264
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00013
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000187   Gene: ENSEEUG00000000217   Transcript: ENSEEUT00000000216
Sequence length 1045
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5583:5:12245:1 gene:ENSEEUG00000000217 transcript:ENSEEUT00000000216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKEKRKDSSHHHHHSASASATPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEE
VEYDMDEEDYIWLDVMNERRKTEGVSPIPQEIFEYLMDRLEKESCFESHNKGDPNALVDE
DAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCAL
CPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQR
GSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRETGANGTSFSVRKTAYCDIHTPPGS
ARRLPALSHSEGEEEEEEEEEEGKSWSSEKVKKAKAKSRIKMKKARKILAEKRAAAPVVS
VPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQ
VGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTP
FLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYR
YLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETG
MHIPHNLAGEEAPQHTEDAAEDERLVLLEKQKHLPVEEQLKLLLERLDEVNASKQSVGRS
RRAKMIKKEMTALRRKLAHQRESGRDGPERHGPSGRGSLTPHPAACDKDGQTDSAAEESS
SQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTAGPPKRPGRPPKNRESQMTPSHGGS
PVGPPQLPIMGSPRQRKRGRSPRPSSSSDSDSDKSTEDPPMDLPANGFSSGNQPVKKSFL
VYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTPSKQGRGKPSFSRGTFPEDSSEDTSGT
ENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDEDSPLDALDLVWAKCRGYPSYPALIIDP
KMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLG
VNQDLDKEKMLEGRKSNIRKSVQIA
Download sequence
Identical sequences ENSEEUP00000000187 ENSEEUP00000000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]