SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000206 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000206
Domain Number 1 Region: 88-185,213-336
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.03e-38
Family FCH domain 0.017
Further Details:      
 
Domain Number 2 Region: 532-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 745-804
Classification Level Classification E-value
Superfamily SH3-domain 6.01e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000206   Gene: ENSEEUG00000000237   Transcript: ENSEEUT00000000237
Sequence length 1089
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_685:57360:268335:-1 gene:ENSEEUG00000000237 transcript:ENSEEUT00000000237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQTKFKKDKEIIAEYEAQIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKXXXXXXXXXXXXXXXXXXXXXVMKTYHMYHTESISAESK
LKEAEKQEEKQFSKSGELSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLLDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
VIENAVDGLDSRSDKHTVMDMCQVFLSPLKFEFQPHGDEVCQVSAQQPVQTELLTRYHQL
QSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYMSK
TNIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRPPC
LPPKPQKMRRPRPLSVCSHKLFNGCMEAFIKXXXXXXXXXXXXXXXXXXXXXLQQQGIFR
VPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLIS
TIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQYSDENMMSPYNLAICFGPT
LMHIPDGQDPVSCQAHVNEVIKTIITHHEAIFPGPRELEGPVYEKCMAGGEEYXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWW
EGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTEHL
PDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPGIDTPPRAAACPSSPHKVPLI
RGRMESPEKRRMATFGSAGSINDPDKKRSTCGSTRHSSLGDHKSLEAEALAEDIEKTMST
ALHELRELERQNTAKQAPDVVLDTLEPLKHPGGPASSEPASPLHTIVIRDPDAAMRRSSS
SSAEMMTTFKPALSARLAGAQLRPPPTRPLRPSAQHRSSSSSSSGVGSPAVTPTEKVFPN
SSTDKSGTM
Download sequence
Identical sequences ENSEEUP00000000206 ENSEEUP00000000206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]