SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000252 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000252
Domain Number 1 Region: 1055-1130
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-26
Family Bromodomain 0.00000821
Further Details:      
 
Domain Number 2 Region: 1987-2042
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 7.45e-26
Family Nuclear receptor coactivator interlocking domain 0.0000595
Further Details:      
 
Domain Number 3 Region: 1697-1776
Classification Level Classification E-value
Superfamily TAZ domain 5.89e-20
Family TAZ domain 0.00000355
Further Details:      
 
Domain Number 4 Region: 315-376
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000000000126
Family TAZ domain 0.0000231
Further Details:      
 
Domain Number 5 Region: 1633-1680
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000283
Family ZZ domain 0.0000823
Further Details:      
 
Domain Number 6 Region: 522-605
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.000000000523
Family Kix domain of CBP (creb binding protein) 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000252
Domain Number - Region: 1211-1250
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0173
Family PHD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000252   Gene: ENSEEUG00000000286   Transcript: ENSEEUT00000000286
Sequence length 2360
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_57:5538:183704:-1 gene:ENSEEUG00000000286 transcript:ENSEEUT00000000286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNV
SASSPVQQGLGGQAPGQPNSTNMASLGAMGKSPLNQGDTAAPSLPKQAASTSGPTPPASQ
ALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVM
NGSLGAAGRGRGAGMPYPTPAMQGATGSVLAETLTQVSPQMASHAGLNTAQAGGMTKMGM
TGNTSPFGQPFSQTGGQQMGTPGVNPQLSSKQNMVNSLPPFPTEIKNASVTNVPNMSQMQ
TPVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMK
NVLNHMTHCQAGKACQAILGSPASGIQNTIGTVGAGQQSATSLSNPNPIDPSSMQRAYAA
LGLPYLNQPQTQLQPQVPGQQPAQPPSHQQMRTLNPLGNNPMNIPSGGMTADQQPPNLIS
ESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSNTGVRKGWHEHVTQDLRSHLVHK
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEYYHLLAEKIYKIQKELEE
KRRSRLHKQGILGSQPALPAPGAQPPGIPQPQTVRPPNGPLPLPVNRMQVSQGMNSFNPM
SLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQVPGAALPNPLNMLGPQANQLPCPP
VTQSPLHQTPPPASTAAGMPPLQHPAAPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVP
SANQTQSTPTVQTAAQAQVTPQPQTPVQPSSVATPQSSQQQPTPVHTQPPGTPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMEEDLQ
GSSQGKEEADAIESKSESMEVDEKKPEVKADTKEEEEGSANGAASQSTSPSQPRKKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYFDIVKNPMDLSTIKRKLDTGQY
QEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFS
PQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQF
EKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAK
RLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSE
SFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRT
AVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKML
DKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEE
STAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEK
HKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWS
TLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGL
GLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKG
CKSKTNGGCPVCKQLIALCCYHAKHCENKCPVPFCLIKHKLRQQQIQHRLQQAQLMRRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNINNGMHLRAVMVT
PVNQMGLSVLRPSQVSGPVMPSLPPAQWQQAPIPQQPPPMAGMPRPMMSMQAQPAVAGPR
MTNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVASQ
PGLQPQPGLQPQPGLQPQPSLHQQPSLQNLNAMQATGPRPGVPPQQQAMGGMNPQGQALN
IMNPGHGTNMVNMNPQYREMLRRQLLQQQQQQQQQQQGTAGMAASMAGHSQFQQPQGPGG
YPPTMPQQRMQQHLPIQGNSMGQMAQMGQLGQMGQPGLGADSAPNIQQALQQRILQQQQM
KQQIGSPGQPNPMSPQHMLSGQPQGSHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPSSS
PSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALNS
ELSLVGDTTGDTLEKFVEGL
Download sequence
Identical sequences ENSEEUP00000000252 ENSEEUP00000000252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]