SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000305 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000305
Domain Number 1 Region: 138-298
Classification Level Classification E-value
Superfamily PUA domain-like 3.48e-61
Family SRA domain-like 0.0000000528
Further Details:      
 
Domain Number 2 Region: 51-102
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000687
Family PHD domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000305   Gene: ENSEEUG00000000346   Transcript: ENSEEUT00000000346
Sequence length 423
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_306:466:9966:1 gene:ENSEEUG00000000346 transcript:ENSEEUT00000000346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYINNCRILFVDEVFKIERSGETTPVVDNPLRRKSGPSCRRCRDDPRKLCRSCACRVCG
GKQDPDKQLLCDECDMAFHLYCLRPPLASVPPEPEWYCPECRTDSSEVVLAGEKLKQSKK
KAKMASATTSSRRDWGKGMACVGRTKECTIVPSNHYGPIPGVPVGSMWRFRMQVSESGVH
RPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLT
NTNRALALNCSAPINDQEGAVAKDWRSGKPVRVVRNMKGRKHSKYAPQEGNRYDGIYKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGEEAAESSTPNKAKR
KSKSAGNSPSDESPGKTYKKSRVESFTLSTEQSRLIKDDKSNSKLWAETLKALKDSTVSP
GSE
Download sequence
Identical sequences ENSEEUP00000000305 ENSEEUP00000000305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]