SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000339 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000339
Domain Number 1 Region: 396-529
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.69e-36
Family Synaptotagmin-like (S variant) 0.00083
Further Details:      
 
Domain Number 2 Region: 541-554,583-694
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.26e-32
Family Synaptotagmin-like (S variant) 0.0036
Further Details:      
 
Domain Number 3 Region: 11-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.87e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000339   Gene: ENSEEUG00000000386   Transcript: ENSEEUT00000000387
Sequence length 727
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4916:11959:65652:1 gene:ENSEEUG00000000386 transcript:ENSEEUT00000000387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVDDKRIRKLKNELLEAKRRSGKTHQET
SRVCVHCQRLGLIFDRGDPCQGCSLRVCSACRVSGLDGSWKCTVCAKVAQLRIITGEWFF
EEKAKRFKQVNVLGTDVIRQSILRRSPGAEEIQNQEKTRRDAEKSNASPSAGPKGSHEGP
RRKGFLLSKFRSATRGEIITPKSESGRSYSLDLDSQHFRGLKSVSGSDXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYLEESE
SINNLVPSRFSANTHSLASGPSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKTGG
LHIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTIS
HTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFESWNFENPSDEWFVLQPKVEFAADITLQ
YKGELTVVLRYIPPEETLILPIGQLQGKKTFKRGKKDSPIIPGGILEVFIKEAKNLTAVK
SGGTSDSFVKGYLLPDDSKATKHKTLVIKRSVNPQWNHTFIFSGLYPQDIKNVCLELTVW
DKEAFSSNVFLGGVRLNSGTGMSHGKNVDWMDSQGEEQRLWQKMADNPGIPIEGVLMLRS
SMGKCKF
Download sequence
Identical sequences ENSEEUP00000000339 ENSEEUP00000000339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]