SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000431 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000431
Domain Number 1 Region: 506-664
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.59e-72
Family N-acetyl transferase, NAT 0.0000000224
Further Details:      
 
Domain Number 2 Region: 252-302
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000421
Family PHD domain 0.0091
Further Details:      
 
Domain Number 3 Region: 92-174
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000185
Family Linker histone H1/H5 0.022
Further Details:      
 
Domain Number 4 Region: 195-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000197
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000431   Gene: ENSEEUG00000000481   Transcript: ENSEEUT00000000483
Sequence length 2003
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_977:4565:58738:-1 gene:ENSEEUG00000000481 transcript:ENSEEUT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDSKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATSVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGPFSKVRTGP
GRGRKRKLLSSQSASSSEEGYLERIDGLDFCTDSNVPLKFNKKTKGLIDGLTKFFTPSPD
GRKPRGEVVDYSEQYRIRKKGNRKSSTSDWPTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEF
CLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTMYCQNLCLLAKLFLD
HKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFL
IDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVS
NSVVSEEEEEEAEEGESEEPQCQERELETSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPILHRRRR
VRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDESELFSR
GYFRHLSSQDVLRCRSSSKRKSKDEEDEESDDADDTPILKPVSLLRKCDVKDSSLEPDTS
TPMKKKKGWPKGKSRKPIHWKKRPGRKPGLKLNREILPVSTQESNIEPIAPIPKSGRKSK
KEERETDESEEDTERMKEEEEGHVETEEVEEGEEEDTTSSEVRAASPVESNNSPETETKE
PEVEEEEEKPRAIEEQRQSEEEQQELEEQEQEEEDEVAVATNQNEDHDADDEDDGHLESI
KKKELEEQPIQEDVKEEEPGGQETFLETNMQSSQENIKDKDETEPDSEEEQTSHETSVIS
EHLPGSEDDHEEDSNSKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHEGAYQDC
EETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSPNVPALE
SGFTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENP
SSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANMGNSCSMMQQNSVQP
AANCNIKSPQSCVVERPPSNQQQPPPPPQQQQQQQQQQQQQQQQQPAPQPPPPQQQQQQQ
QQPPQPQQPQPPPPPQQQPPLSQCSMSNSFPPAPMIMEIPESGSTGNISIYERIPGDFGA
GSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLA
GTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKS
APLPSAAAHQQQLYGRSPPAVAMQAGPRALTVQRGMNMGVNLMPTPAYNVNSMNMNTLNA
MNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGP
SHHSYMNAAGVPKQSLNGPYMRR
Download sequence
Identical sequences ENSEEUP00000000431 ENSEEUP00000000431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]