SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000477 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000477
Domain Number 1 Region: 321-641
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-75
Family p120GAP domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 600-735
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-43
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 150-231
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000141
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 4 Region: 46-115
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000521
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000477   Gene: ENSEEUG00000000539   Transcript: ENSEEUT00000000541
Sequence length 736
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5506:4362:154340:1 gene:ENSEEUG00000000539 transcript:ENSEEUT00000000541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAKNLLPYLGPHKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVHLELKLNELITENGTVCQQLVVHIRAC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGPLKSLLLKSPDVQPISASAAYILGEICREKNDA
VLPLVRLLLHQDVLCTAVALDWDIQDANTIFRGNSLATRCLDEMMKIVGRHYLKVTLKPI
LDEICESSKPCEIDPIKLKEGDNVENNKENLRYYVDKLFSTIIKSSMSCPTVMCDIFYSL
RQMATQKFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLISKTI
QTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVH
LKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGKDAIYTIPVKNILAVEKLEE
SSFNKKNMFQVIHTEKPLYVQANNCVEANEWIEVLCRVSRCNQNRLSVYHPSAYLSGIWL
CCQETSENTLGCKPCT
Download sequence
Identical sequences ENSEEUP00000000477 ENSEEUP00000000477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]