SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000583 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000583
Domain Number 1 Region: 84-142
Classification Level Classification E-value
Superfamily HMG-box 1.44e-16
Family HMG-box 0.00051
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000916
Family HMG-box 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000583   Gene: ENSEEUG00000000665   Transcript: ENSEEUT00000000663
Sequence length 143
Comment pep:novel scaffold:HEDGEHOG:scaffold_118128:895:1350:1 gene:ENSEEUG00000000665 transcript:ENSEEUT00000000663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVLREAPKPRISTFAFFLRMCKAEHQEKKPGARMNLVEFSRKCFRRWRMLSEEEKNAFRD
LARAECERNDPQTRGHGPAGRRERDSASFLFSSDFRPKVKADYPDITSGNMSKKLGEMWS
NLSNKEKRLYEDRVAQLRMQYNM
Download sequence
Identical sequences ENSEEUP00000000583 ENSEEUP00000000583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]