SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000665 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000665
Domain Number 1 Region: 415-494,539-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-32
Family SPRY domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000665
Domain Number - Region: 109-157
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000665   Gene: ENSEEUG00000000751   Transcript: ENSEEUT00000000751
Sequence length 626
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3449:344:100415:1 gene:ENSEEUG00000000751 transcript:ENSEEUT00000000751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGTGPGPGVGAGSVPAVSATANATASEEGETKPAVAVAAAPAGEGPAAEAGSGEPES
GDANMVDVSGGLETESSNGKDTSEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTK
WFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRT
QDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDP
GSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNXXIAAGSSGKGRGAKRKQ
QDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDC
WAGKPIPGDLYRACLYERVLLALHDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKGTWY
FEITVDDMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQ
GDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEII
FYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAV
VEHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences ENSEEUP00000000665 ENSEEUP00000000665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]